PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008241933.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 273aa    MW: 31202.8 Da    PI: 5.6625
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008241933.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.25e-2291151257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     r+R+t+t+ ql++Le+lFe+ n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  XP_008241933.1  91 RQRWTPTPVQLQILERLFEQgNGTPSKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 151
                     89*****************99**************************************97 PP

2Wus_type_Homeobox101.65.5e-3390153265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+l+++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
     XP_008241933.1  90 ARQRWTPTPVQLQILERLFEQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 153
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1886156IPR009057Homeodomain-like
PROSITE profilePS5007115.3787152IPR001356Homeobox domain
SMARTSM003895.8E-1589156IPR001356Homeobox domain
SuperFamilySSF466893.12E-1990156IPR009057Homeodomain-like
PfamPF000468.1E-2091151IPR001356Homeobox domain
CDDcd000863.80E-1391153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MMEWEKLQQK EHEMDGQANG NGNGGVLYVK VMTDEQLETL RKQIAVYASI CEQLVEMHKN  60
LTAQQDLAGV RMGNLYCDPL MTSAGHKITA RQRWTPTPVQ LQILERLFEQ GNGTPSKQKI  120
KEITSELSQH GQISETNVYN WFQNRRARSK RKQQNAACNH AESEVETEVD SPKDKKTRPE  180
ELFQSQQNSA QRTEDLCFQS PEISSDLHFL DPQTTKTDKM FPSNSGLRTS RHLSEMSFYD  240
EVLSNSRNDL MTGKIEAGNY NLFQQAEDYG MTG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144152RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241933.10.0PREDICTED: WUSCHEL-related homeobox 13
SwissprotO817881e-96WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A072VS221e-133A0A072VS22_MEDTR; Uncharacterized protein
STRINGVIT_04s0044g00150.t011e-122(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.17e-98WUSCHEL related homeobox 13